Bra

The Japanese company manufactured the longest bra in September, 1990. The bra has an under-burst measurement of 24m (78ft 8 in) and 28m (91ft 10in) for its bust measurement.

Tunnel

Image source

The Seikan Tunnel (as shown above) between Japan’s Honshu and Hokkaido Islands is currently considered as the world’s longest tunnel with its measurement of 53, 850m in length. However, by 2010, with the opening of the tunnel called Gotthard Base in Switzerland, Seikan Tunnel will be placed the second as it is 3,222m shorter than the Gotthard Base (57,072m).

Coastline

Image source

Canada has the longest coastline measured 152,100 miles in length. In contrary to Canada, the Monaco has the shortest coastline (3.5miles).

Wave

Image source

The Araguari Pororoca in Amazon generates the longest wave on earth. Its tidal bore generates wave up to a maximum of 12ft high that lasts for over half an hour. Nevertheless, surfing through this world’s longest wave is risky, frightening and dangerous. The Tupi-Guarani Indians themselves have once expressed their fear by calling it “poroc poroc”, or in English translates as “great destructive noise”. It is recorded that this wave is powerful enough to tear off the entire trees from the river bank, local houses and even it can destroy living things on earth. The wave can be heard 30 minutes before its arrival. Though it is notorious for its frightening and dangerous tidal phenomenon, it still tempts the surfers to ride on it as its massive wave lets them to stay on their boards for a relatively long hour.

Moustache

Photo credit: Rajesh Rajan, UMS, Muscat, Oman

Mohammed Rashid is a Turkish who has an incredibly long moustache measured 1.6m (5ft 3in ) long. He is currently considered as the man with the longest moustacle in the world. In Turkey, the moustache symbolises one’s personality as its saying goes, “You can always tell a man’s connection with its moustache.”

Snake

Photo credit: Stephen J Fleay

This is a python found living in a tourism park in central Java which was the longest and heaviest snake ever capture in Indonesia in 2004. Its weight was 447kg while its length was 14.85m. More details on long snake, please read here.

Places

El Pueblo de Nuestra Senora la Reina de Los Angeles de Porciúncula

Image source

This is the earlier name given to LA (Los Angeles), the North America’s second largest city when its first settlement was established in 1781. It translates in English as “The Town of Our Lady the Queen of Angels of the Little Portion.” Officially, this 55-letter place name was later named as “El Pueblo de la Reina de Los Angeles.”

Taumatawhakatangihangakoauauotamateaturipukakapikim- aungahoronukupokaiwhenuakitanatahu

Image source

This is a Maori name for a hill, 305m high, near Porangahau, Hawkes Bay, found in New Zealand which has officially entered the Guinness Book of Records. This 85-letter-long place name is a combination of the words taumata (brow of a hill), whakatangihanga (music making), koauau (flute), o (of), tamatea (name of a famous chief), turi pukaka (bony knees), piki maunga (climbing a mountain), horo (slip), nuku (move), pokai whenua (widely travelled), ki (to), tana (his), tahu (beloved). Therefore, it means: the summit of the hill, where Tamatea, the man with the big knees who slid down, climbed up and swallowed mountains, known as land eater, played on his flute to his loved one. Nowadays, it has been abbreviated to Taumata. Visitors climb the hill with their four-wheel-drive vehicles and they are tempted to the Duke of Edinburg Hotel to buy a “Collectors’ Longest Place Name Bottle of Hawkes Bay Chardonnay or Cab Merlot.”

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogo- gogoch

Image source

This is a 58-letter-name that is given to a town in North Wales which is listed in the Guinness Book of World Records. In English it means “Saint Mary’s Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave.” The local pronounce it as “thlan vire puth” and called it as “Llanfairpwll.” According to Wales resources, this world-famous station and village was created by a local humorist in the early of 19th century. It is said that the station of Llanfairpwll or L56h was first opened on Anglesey Island in 1848 and closed for twenty years (1973 – 1993). Later, it was re-opened in 1994.

Chargogagogmanchargogagogcharbunagungamog

This is a name given to a town in Wales. It means: the Mawddach station and its dragon teeth at the Northern Penrhyn Road on the golden beach of Cardigan bay.

Gorsafawddachaidraigodanheddogleddolonpenrhynareurdr-aethceredigion

This is the longest name found in the United States, and it is given to name Lake Webster in Massachusetts. Alternatively, it could be spelled as Chargoggagoggmanchauggagoggchabunagungamaugg, Chargoggagoggmanchauggagoggchaubunagungamogg, and Chargoggagoggmanchauggagoggchaubunagungamogg.

NUNATHLOOGAGAMIUTBINGOI

According to The Book of Names written by J.N.Hook, this Eskimo name is used to name some dunes found in Alaska.

Krungtheomahanakornbowornratanakosinmahintarayudhy-aamahadilokpopnoparatanarajthaniburiromudomrajniwesm-ahasatarnamornpimarnavatarsatitsakattiyavisanukam

This is the world’s longest name found in Thailand ever declared by the World Meteorological Organization (WMO). It’s not surprising to find that not only local people but also foreigners could hardly memorise this long place name. It is later referred to the local as Krung Thep, or in English it translates Jewelled City of the God Indra. This is a qualified Thai name for Bangkok city, as the above long name describes Bangkok as a city of God Indra, the grand capital of the world endowed with nine precious gems, the happy city, abounding in an enormous Royal Palace that resembles the heavenly abode where reigns the reincarnated god, a city given by Indra and built by Visnukarn (Vishwakarma, the builder for the Hindu Gods.)

This hilariously long place name is a combination of the words krungthep mahanakorn (The great city of angels), amorn rattanakosin mahintara yutthaya mahadilok phop (the supreme unconqueralble land of the great immortal divinity (Indra), noparat rajathani burirom (the royal capital of nine noble gems, the pleasant city), udomrajaniwes mahasatharn (with plenty of grand royal palaces), amorn phimarn avatarnsathit (and divine paradises for the reincarnated deity [Vishnu] ), sakkatattiya visanukam prasit (given by Indra and created by the god of crafting [Visnukarma] ). This is a name given by King Rama I, the founder of the city in a celebration to the new capital after Sukhothai, Thonburi and Ayudhaya 219 years ago. But, it was said by Theppitak Karoonboonyanan that the 163-letter of Krung¬thep¬maha¬nakorn¬amorn¬ratana¬kosin¬mahintar¬ayutthay¬amaha¬dilok¬phop¬noppa¬ratrajathani¬burirom¬udom¬raj-aniwes¬mahasat¬harn¬amorn¬phimarn¬avatarn¬sathit¬sakkattiya¬visanukamprasit will be its appropriate correct spelling.

Puzzle

This fun, additive, challenging and mind-blending puzzle riddle is by far the longest puzzle ever created. It consists of 200 levels. Not only it is the longest, but also it is the hardest to solve. Out of 6,000 people who attempted to solve it, only 11 out of them have made their ways to pass through its 100 levels. No one in this world has solved it up to 200 levels. This timtangtest requires the combination skills of maths, music, and of course your patience and perseverance to get it solved. Before starting this test, you should attend its tutorial and read its homepage carefully to understand the purpose and mechanism of the test.

Domain Name

Some companies prefer to register a relatively long domain name for the purpose of a publicity stunt and media attraction as well. However, this long domain name does not help the visitors to memorise the selected domain name perfectly. Below are longer domain names ever registered.

lerelaisinternet-com-favorise-la-croissance-de-votre-entreprise.eu.

This long domain name was registered by a French company in French with the aims to facilitate the growth of its business.

3.141592653589793238462643383279502884197169399375105820974944592.com

This domain name has the first 65 characters of the value of Pi to one million decimal places. It was registered by a German technology company.

aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa.eu zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz.eu

Both of these domain names were generated with all its characters in the same alphabet.

Escalator

Photo credit: David Astley

This is one of the escalators found in Pyongyang’s metro in North Korea. It seems that it will go on as far as you could see its end. This escalator goes down to the station platform.

Image source

This is the escalator found in Umeda Sky Building, the tallest building in Osaka City, Japan. This building consists of two 40 story towers and is situated in the Umeda district of Kitaku in Osaka, Japan. This escalator is the longest in Japan.

Epic

“King Gesser” is the world’s longest epic that is still passed down from generation to generation for a thousand year in Qinghai Province and Tibetan Autonomous Region in western China. This epic contains 10 million words and more than 200 parts. It tells the story of the ancient Tibetan King who conquered the devils of other Tibetan tribes.

Beach

Photo credit: Smith

This is the world’s longest freshwater beach with its length about eight and a half miles. It is a Wasaga beach in Canada. The visitors can enjoy hiking and boating here.

Photo credit: Michael Tim

This beach is always claimed as the world’s longest beach. This thirty-mile-long beach is the Long Beach of Washington. It is ranked as the longest beach on the United States’ West Coast.

Photo credit: Jongtu

With its over 150 miles long beach, Praia do Cassino Beach in Brazil, is by far the longest beach in the world. It is famous for its warm temperature, and pure white sand. Surfing is the most popular pastime here.

Photo credit: Mohammed

This is Cox’s Bazar Beach of Bangladesh. It is the world’s longest natural sand beach which stretches across 150 miles. The local people call this beach “Panowa”, or in English it translates “little flower.”

Joke

This is the world’s longest joke ever created. The joke is given a title as “Lost in The Desert”. Since it is terribly long, I leave its link here. Have fun reading this joke!

Song

Supercalifragilisticexpialidocious is an English song in the musical film of Mary Poppins. Its song was written by the Sherman Brothers, and sung by Dick van Dyke and Julie Andrews.

Railroad

Image source

The Trans-Siberian Railroad is regarded as the world’s longest railroad. From Moscow, its eastern terminus in Vladivostok is 9289km or 5,772 miles.